PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G058600.1.p
Common NameGLYMA_11G058600, LOC100817326
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 343aa    MW: 37511 Da    PI: 7.5375
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G058600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.94.8e-33193248156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rFv+a++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Glyma.11G058600.1.p 193 KQRRCWSPELHRRFVDALQQLGGAQVATPKQIRELMQVEGLTNDEVKSHLQKYRLH 248
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.032190250IPR017930Myb domain
SuperFamilySSF466891.97E-18191251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-30191251IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-27193248IPR006447Myb domain, plants
PfamPF002495.7E-8195246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MELSLDLSLG FVPKPLSLFF ADVSANRDKV ATLDGFVQRL EEELKKVEAF KRELPLCILL  60
LNDAIARLKE EKVKCSGMQD PPLKTSSGGN KNESSEKMNW MSSAQLWSTQ KTKSRNEEDD  120
RSVPANPING NSCVLEKEGS QVPRFGLMAR ASELSHSNSK SVGGDISSGS SLLRVEVQSQ  180
PQPPQHMQQN PRKQRRCWSP ELHRRFVDAL QQLGGAQVAT PKQIRELMQV EGLTNDEVKS  240
HLQKYRLHVR RFPVSSTGQA DNGSWMSQDE SGDKSKGNNM SQSGSPQGPL TPLILGGGGG  300
GSAKGLSSPG QNSVDGEDEQ SDCRNWKGGL HHHQLEADNQ CL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.272940.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538823.10.0PREDICTED: uncharacterized protein LOC100817326
TrEMBLA0A0B2SCP90.0A0A0B2SCP9_GLYSO; Putative transcription factor KAN3
TrEMBLI1LHG80.0I1LHG8_SOYBN; Uncharacterized protein
STRINGGLYMA11G06230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-58G2-like family protein